PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P36450_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 232aa    MW: 26906.1 Da    PI: 6.4069
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P36450_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45.2e-183789456
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           + +++ eq+++Le+ F + +++  e++ eLA++lgL+ rq+ +WFqNrRa++k
  GSMUA_Achr6P36450_001 37 KKRLNLEQVRTLEKSFVMGKKLEPERKMELARSLGLQPRQIAIWFQNRRARWK 89
                           4568889*********************************************9 PP

2HD-ZIP_I/II123.69.6e-4035125191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekk+rl+ eqv++LE+sF + +kLeperK+elar+Lglqprq+a+WFqnrRAR+k kqlEkdy+ Lkr+++ +k++n++L+++++eL 
  GSMUA_Achr6P36450_001  35 EKKKRLNLEQVRTLEKSFVMGKKLEPERKMELARSLGLQPRQIAIWFQNRRARWKIKQLEKDYDELKRQFEMMKAQNDALHAHNKELL 122
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                            +++
  GSMUA_Achr6P36450_001 123 SQI 125
                            987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.08E-192692IPR009057Homeodomain-like
PROSITE profilePS5007116.733191IPR001356Homeobox domain
SMARTSM003891.2E-173495IPR001356Homeobox domain
CDDcd000867.67E-163692No hitNo description
PfamPF000462.4E-153789IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-193998IPR009057Homeodomain-like
PRINTSPR000311.6E-66271IPR000047Helix-turn-helix motif
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
PRINTSPR000311.6E-67187IPR000047Helix-turn-helix motif
PfamPF021832.2E-1391131IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MDAGRRSTSF SGMETCEELN LEDDISDDGL QPPGEKKKRL NLEQVRTLEK SFVMGKKLEP  60
ERKMELARSL GLQPRQIAIW FQNRRARWKI KQLEKDYDEL KRQFEMMKAQ NDALHAHNKE  120
LLSQILSLKG KDVSESINLN KETEGSCSMR SENSPDISLE ISREPMNHNP SDLHQQSRTF  180
FPSASQLLHS SSKSETPKVE SSVQRDNLCN MFYSTDDQSA FWAWSEQHNF HQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18391RRARWKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407204.11e-169PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_009407205.11e-169PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-74ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLM0TD871e-173M0TD87_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P36450_0011e-172(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-74HD-ZIP family protein